top of page

CircRNA

Gene

chr1|93191999|93212261|+|7|circRNA|CCDC18|ENST00000343253.11|5,6,7,8,9,10,11

CCDC18

Open Reading Frame (ORF)

LTANQLSQSLITCNDSQESSKLSSLETEPVKLGGHQVGFYA

Peptide

LGGHQVGFYA

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page