top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|93183359|93207398|+|8|circRNA|CCDC18|ENST00000343253.11|2,3,4,5,6,7,8,9

CCDC18

Open Reading Frame (ORF)

MAVKNSEVMAQLTESRQSILKLESELENKDEILRDKFSLMNENRELKVRVAAQNERLDLCQQEIESSRVELRSLEKIISQLPKWNLVHQTTIIKTMKRKVCLQMLLP

Peptide

WNLVHQTTIIKTMK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page