top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|92177810|92182595|+|3|circRNA|KIAA1107|ENST00000370378.4|6,7,8

KIAA1107

Open Reading Frame (ORF)

LMKMWQSWTTIQLQRNKHLREKWSSKYTQLCLRLMQK

Peptide

LMKMWQSWTTIQLQR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page