top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|88771662|88786213|+|3|circRNA|PKN2|ENST00000316005.11|6,7,8

PKN2

Open Reading Frame (ORF)

LWLAKLAGNPFPISHGTRSLHWNWTGLKQDLMNQVRSWTF

Peptide

QDLMNQVR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page