top of page

CircRNA

Gene

chr1|86715723|86735179|+|7|circRNA|SH3GLB1|ENST00000616170.4|2,3,4,5,6,7,8

SH3GLB1

CircRNA UID

circSH3GLB1(2,3,4,5,6,7,8)

Open Reading Frame (ORF)

LNDFVEAQMTYYAQCYQYMLDLQKQLGSSQKKSLARLRRQNWMLT

Peptide

QLGSSQK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page