top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|61775205|61808530|+|8|circRNA|INADL|ENST00000316485.10|7,8,9,10,11,12,13,14

INADL

Open Reading Frame (ORF)

LLLWTHRLQMMLSYRNIQRFVGAMLKRLSSLMMALD

Peptide

FVGAMLK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page