top of page

CircRNA

Gene

chr1|53594107|53600278|-|2|circRNA|GLIS1|NM_147193|3,2

GLIS1

CircRNA UID

circGLIS1(3,2)

Open Reading Frame (ORF)

MSFQSSLGLTSRACRPPIPCLSCRLAQALEAWGWAWQAGWWPGGRRAAGWTAVQPMSSRRSWCGTSRRATSTSARARTSPASGLAACAATSPSTPATSCSSTCECTRARSPTSACEWELRTPYPGLREEPAGPGPC

Peptide

ATSTSARAR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page