top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|51781163|51782643|+|2|circRNA|OSBPL9|ENST00000371714.5|18,19

OSBPL9

Open Reading Frame (ORF)

MVPLSLSCGKERISCQKAIQSHFGRDFSVSLDITK

Peptide

AIQSHFGRDFSVSLDITK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page