top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|46055794|46066179|-|3|circRNA|PIK3R3|ENST00000262741.9|7,6,5

PIK3R3

Open Reading Frame (ORF)

MMNYDKLKSRLGEIHDSKMRLEQDLKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVISW

Peptide

IRDQHLVISW

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page