top of page

CircRNA

Gene

chr1|35397376|35415714|+|9|circRNA|ZMYM4|ENST00000314607.10|20,21,22,23,24,25,26,27,28

ZMYM4

Open Reading Frame (ORF)

LSLCLFHLQWIVKIKSQRVLKTLKKSFPHIHLKLISLRWQK

Peptide

LSLCLFHLQWIVK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page