top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|35381258|35415714|+|21|circRNA|ZMYM4|ENST00000314607.10|8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28

ZMYM4

Open Reading Frame (ORF)

MFSRIEEEHLWECKQLGAYSPIVLLNTLLFFNTKYFQLKNVTEHLKLSFAHVMRRTRTLKYSTKMTYLRFFPPLQKQESEPETF

Peptide

FFPPLQKQESEPETF

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page