top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|32825312|32826930|+|2|circRNA|S100PBP|ENST00000373476.5|2,3

S100PBP

Open Reading Frame (ORF)

LNSLLVPLSCLKTVPHFLGIPWMRMDWMTPCWSCQREKKMMVM

Peptide

MDWMTPCWSCQR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page