top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|32037834|32038619|+|2|circRNA|KHDRBS1|NM_001271878|5,6

KHDRBS1

Open Reading Frame (ORF)

MMIHTQNKVTKATKAITARVKGAVVLDHLGGLWYVVHQ

Peptide

ATKAITAR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page