top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|29159373|29166912|-|5|circRNA|SRSF4|ENST00000605204.1|7,6,5,4,3

SRSF4

Open Reading Frame (ORF)

MVIEEVAEINMALLLAQSTDLLWRICQVGAAGKT

Peptide

MVIEEVAEINMALLLAQSTDLLWR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page