top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|28989355|28993542|+|2|circRNA|EPB41|NM_004437|3,4

EPB41

Open Reading Frame (ORF)

MTQFMNVLWSLTITIKNYFQSLLISEACEYYLHR

Peptide

MTQFMNVLWSLTITIK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page