top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|26794112|26795234|+|1|circRNA|PIGV|NM_017837|3

PIGV

Open Reading Frame (ORF)

LDSSVLRCLCTWSTLQCCCCLEVCACMFRPSSMPSSQITMQKPSLLLAWPPQALWTNSWKVFWAACLTGMLNTSCSLLSMATCMSTTLPSFLVSPWPCWWGLNC

Peptide

LDSSVLR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page