top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|246905540|246918377|-|5|circRNA|AHCTF1|ENST00000366508.5|6,5,4,3,2

AHCTF1

Open Reading Frame (ORF)

LYMLSLFKNLRMILGIAVTCGLFSLHKIVEVCET

Peptide

MILGIAVTCGLFSLHK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page