top of page

CircRNA

Gene

chr1|243156220|243191494|-|7|circRNA|CEP170|ENST00000366542.5|14,13,12,11,10,9,8

CEP170

Open Reading Frame (ORF)

MPSKLRNNLQLQMKKYFFLSVGNQVILKSLQKNSSNHHK

Peptide

LRNNLQLQMK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page