top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|236806143|236891329|+|26|circRNA|MTR|ENST00000535889.5|3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23,24,25,26,27,28

MTR

Open Reading Frame (ORF)

LASTEYPRRHSPVRRGCCAPGCRAHSHLLWVKATGILAGWGRYH

Peptide

ATGILAGWGR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page