top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|235419472|235448440|+|12|circRNA|TBCE|ENST00000406207.4|5,6,7,8,9,10,11,12,13,14,15,16

TBCE

Open Reading Frame (ORF)

MTIQKVKGLLSRLLKVPVSDLLLSYESPKSAEQVARSFSEELCSKLCW

Peptide

VPVSDLLLSYESPKSAEQVAR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page