top of page

CircRNA

Gene

chr1|235419472|235430804|+|3|circRNA|TBCE|ENST00000406207.4|5,6,7

TBCE

Open Reading Frame (ORF)

LKVLVLNQTGITWAESAEQVARSFSEELCSKLCW

Peptide

SAEQVAR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page