top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|232460886|232515608|-|8|circRNA|SIPA1L2|ENST00000366630.5|9,8,7,6,5,4,3,2

SIPA1L2

Open Reading Frame (ORF)

LLKVSTKLSSSRLSWRRADWRGAFALGIVSDVLHIMMSRAFCLISTKPWLRGLMWGKGKT

Peptide

ADWRGAFALGIVSDVLHIMMSR

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page