top of page

CircRNA

Gene

chr1|23030550|23057560|+|1|new|KDM1A|ENST00000356634|27010|0

KDM1A

Open Reading Frame (ORF)

LNSHFMKYDAYIQKIGIGLVFLPRPPPPPPPHHSSLFGTHFGVLIWTYAPKYLTGGLREESDKLKR

Peptide

YLTGGLR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Novel in Short-Read

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page