top of page

CircRNA

Gene

chr1|229530198|229531731|-|2|circRNA|ABCB10|ENST00000344517.4|8,7

ABCB10

Open Reading Frame (ORF)

MRKASRVLWSLRTCILPIQLAQRCPYFRISAFPFRQDLSRHWLAQVVLANQQCFHSC

Peptide

ISAFPFR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page