top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|220153184|220162268|-|6|circRNA|RAB3GAP2|NM_012414|33,32,31,30,29,28

RAB3GAP2

Open Reading Frame (ORF)

LKVVSAAVQAQHSATKVKDPTEEATPTPFGKDQDWPALAVDLAHHLQVSEDVVRRHYVGELYNYGVDHLGEEALH

Peptide

RHYVGELYNYGVDHLGEEALH

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page