top of page

CircRNA

Gene

chr1|21701497|21703618|-|2|circRNA|USP48|ENST00000400301.5|22,21

USP48

Open Reading Frame (ORF)

LKQRRTRKKLNQMEKKIQILIKTLSRMQRRLIVSAAEGPA

Peptide

LIVSAAEGPA

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page