top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|214393694|214464957|-|9|circRNA|PTPN14|ENST00000366956.9|10,9,8,7,6,5,4,3,2

PTPN14

Open Reading Frame (ORF)

MISKMPSIFLGCLPHDTSFTNKTKSALTIFQRATLGMDTLFPAWRSTGDSVIFQSRNC

Peptide

ATLGMDTLFPAWR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page