top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|213240701|213242658|+|2|circRNA|RPS6KC1|ENST00000543354.5|10,11

RPS6KC1

Open Reading Frame (ORF)

LQKFTCSSQLLVLRTAVALNPEEVMVEACLKLCL

Peptide

FTCSSQLLVLRTAVALNPEEVMVEACLK

ORF Found in Long-Read

false

Peptide Length

28

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

28

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page