top of page

CircRNA

Gene

chr1|211356366|211361162|+|2|circRNA|TRAF5|ENST00000462410.5|4,5

TRAF5

Open Reading Frame (ORF)

MYIAAMLLDVMPRLFWAGTRLVLLMNDICFCHFSRNVC

Peptide

MYIAAMLLDVMPR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page