top of page

CircRNA

Gene

chr1|20840855|20942330|-|17|circRNA|EIF4G3|NM_003760|25,24,23,22,21,20,19,18,17,16,15,14,13,12,11,10,9

EIF4G3

Open Reading Frame (ORF)

MTDVNSHPQEKTQFLYPASHLAQKHQTLYQQMKMMMIYARNPVV

Peptide

MMMIYAR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page