top of page

CircRNA

Gene

chr1|206303280|206303473|+|1|circRNA|SRGAP2|NM_001300952|2

SRGAP2

Open Reading Frame (ORF)

MKCLDQQCELRVQLLQDLQDFFRKKAEIEMDYSRNLEKLAERFLAKTRSTKDQQFKDPCSAHRADEMPGPAV

Peptide

ADEMPGPAV

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page