top of page

CircRNA

Gene

chr1|205661860|205664886|-|3|circRNA|SLC45A3|ENST00000367145.3|4,3,2

SLC45A3

Open Reading Frame (ORF)

LRCPTAAGVEHGLRSWTGTKGLAEMGAWLIPRQLAAARRRGRSFWSRAETKQFWSA

Peptide

GLAEMGAWLIPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page