top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|204454668|204469886|-|11|circRNA|PIK3C2B|ENST00000367187.7|13,12,11,10,9,8,7,6,5,4,3

PIK3C2B

Open Reading Frame (ORF)

MKISTSPAPSAMAARSCAAPCRPEELTSPSTSSTSSSGTSSAQTPCHNPPELTLAGSRDFVACVPHPHHVFDSGQWGTLEVPGVSGHQPQRASDGRSPADGV

Peptide

ISTSPAPSAMAAR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page