top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|204247364|204257869|-|5|circRNA|PLEKHA6|ENST00000272203.7|13,12,11,10,9

PLEKHA6

Open Reading Frame (ORF)

LGPGGQAPCLPQWGWPCLPAARVEGARQLRAAGCHRLDPKPLPAASLL

Peptide

VEGARQLR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page