top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|201996146|201997554|+|2|circRNA|RNPEP|ENST00000481780.5|4,5

RNPEP

Open Reading Frame (ORF)

LGTAPWQMSSSMRSPTVGLGTWSPTPTGVNSGSMKVSPCTPRGGSPPSSLEPGVG

Peptide

GGSPPSSLEPGVG

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page