top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|198232552|198293039|+|7|circRNA|NEK7|ENST00000367385.8|2,3,4,5,6,7,8

NEK7

Open Reading Frame (ORF)

MSPERIHENGYNFKSDIWSLGCLLYESSKVPVASDNG

Peptide

IHENGYNFKSDIWSLGCLLYESSK

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page