top of page

CircRNA

Gene

chr1|185160832|185175113|+|4|circRNA|SWT1|NM_001105518|2,3,4,5

SWT1

Open Reading Frame (ORF)

LNIYFQILHISGLFMSGNENIIMTIKKVMIHILGKT

Peptide

KVMIHILGK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page