top of page

CircRNA

Gene

chr1|175986942|176046324|-|7|circRNA|RFWD2|NM_001001740|17,16,15,14,13,12,11

RFWD2

CircRNA UID

circRFWD2(17,16,15,14,13,12,11)

Open Reading Frame (ORF)

LEGTTRWVLNLTGIVTILRLLELQRRLKSMNMTLSSRMQWIFITLRMK

Peptide

LLELQRR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page