top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|175986942|176027688|-|4|circRNA|RFWD2|NM_001001740|17,16,15,14

RFWD2

Open Reading Frame (ORF)

LIQSKVFSTKTEKKMIQMNLLVLCAGGHYQMGEAVVYQSRQLSGKH

Peptide

KMIQMNLLVLCAGGHYQMGEAVVYQSR

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page