top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|171523220|171542229|+|9|circRNA|PRRC2C|NM_015172|8,9,10,11,12,13,14,15,16

PRRC2C

Open Reading Frame (ORF)

LKDQNLKKYINLNQKLVGAHDQALTEGKKLMIDL

Peptide

LKDQNLK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page