top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|159918837|159920537|-|4|circRNA|TAGLN2|ENST00000397334.2|5,4,3,2

TAGLN2

Open Reading Frame (ORF)

LQEGKNVIGLQMGTNRGASQAAPRSHRHPLEWPTGDLHMA

Peptide

GASQAAPR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page