top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|156475107|156483430|-|8|circRNA|MEF2D|NM_005920|9,8,7,6,5,4,3,2

MEF2D

Open Reading Frame (ORF)

MPSALGSPSLLIRSPPQWFLWQRRVYSARASPSLPCPLPTTQEAVQKVSCRP

Peptide

ASPSLPCPLPTTQEAVQK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page