top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|149664520|149669310|+|3|circRNA|LINC00869|NR_111950|6,7,8

LINC00869

Open Reading Frame (ORF)

LSSCIMKTEFSEKNTGDSPDLPESNFQRINPNAH

Peptide

NTGDSPDLPESNFQRINPNAH

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page