top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|1337976|1338653|-|3|circRNA|DVL1|ENST00000378891.9|14,13,12

DVL1

Open Reading Frame (ORF)

LPPGLWVRATPTSTRDPHPASRLPTRTRALAMAAAAPGVSRVKSWKRRR

Peptide

ALAMAAAAPGVSR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page