top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|120784973|120793496|+|2|circRNA|AC253572.1|ENST00000624419.1|3,4

AC253572.1

Open Reading Frame (ORF)

LPEWWDLCGPGHAGESHVPVCLRVYRRGLPVLDTSSMLCVSTLPEWRHMPYAQPGYL

Peptide

LPEWWDLCGPGHAGESHVPVCLR

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page