top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|111194577|111199798|-|6|circRNA|DENND2D|NM_024901|7,6,5,4,3,2

DENND2D

Open Reading Frame (ORF)

LTRPLDSHLEHVDFSSLLHCLSFEQILQIFASAVLERKIIFLAEGLRTTPGQFRGSFKGTRKGPGALFAQLCWGAALL

Peptide

IIFLAEGLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page