top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr1|109336239|109342158|-|3|circRNA|SORT1|NM_001205228|11,10,9

SORT1

Open Reading Frame (ORF)

LKTVNVMLQQKTRMRIQQEGSTFQQIKGTHGAWPSSPPWDRNSSILFWQQMMTWYSCM

Peptide

GTHGAWPSSPPWDR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page