top of page
Peptides from immunopeptidome samples
Use criteria below to search
Gene | Transcript | Peptide | Modified peptide | Peptide length | protein length | Chr | Start | End | Strand | type | High.efficiency.TIS.motif |
|---|---|---|---|---|---|---|---|---|---|---|---|
LINC01553 | ENST00000521074.1 | LSNYTSLKLR | 10 | 60 | 10 | 59956991 | 59957173 | - | ncRNA | - | |
LOC105370265 | XR_001749927.1 | LSPALEFLPCGPFLSSSSIFILLEMDYKRS | LSPALEFLPCGPFLSSSSIFILLEM[147]DYKRS | 30 | 31 | 13 | 76715762 | 76715857 | - | ncRNA | - |
PRR7 | XM_017009896.1 | LSPDCAGR | LSPDCAGR | 8 | 202 | 5 | 177454426 | 177455034 | + | 5'UTR | - |
LOC101929550 | NR_125819.1 | LSPDIAPRPWISQPPER | 17 | 91 | 8 | 35673001 | 35679951 | - | ncRNA | - | |
ARRB2 | ENST00000577054.1 | LSPQGRETTMR | 11 | 49 | 17 | 4717508 | 4717657 | + | ncRNA | - |
Page 1 of 1
bottom of page