top of page
Peptides from immunopeptidome samples
Use criteria below to search
Gene | Transcript | Peptide | Modified peptide | Peptide length | protein length | Chr | Start | End | Strand | type | High.efficiency.TIS.motif |
|---|---|---|---|---|---|---|---|---|---|---|---|
LOC105373802 | XR_001739161.1 | NKTVFKSQLCNP | NKTVFKSQLCNP | 12 | 37 | 2 | 190445886 | 190445999 | - | ncRNA | - |
LOC105373802 | XR_001739162.1 | NKTVFKSQLCNP | NKTVFKSQLCNP | 12 | 37 | 2 | 190445886 | 190445999 | - | ncRNA | - |
RHOBTB1 | XM_011540428.1 | NLAANVNAHVYGCLMASPGGGHLFSTPCWR | NLAANVNAHVYGCLMASPGGGHLFSTPCWR | 30 | 80 | 10 | 60883172 | 60883414 | - | 3'UTR | - |
CD1B | XM_017002785.2 | NLALCLLPHYGNPTSLPQPR | NLALCLLPHYGNPTSLPQPR | 20 | 48 | 1 | 158285851 | 158285997 | - | 3'UTR | - |
CFAP44 | ENST00000393845.8 | NLAWRVMKMSLNQK | NLAWRVM[147]KM[147]SLNQK | 14 | 62 | 3 | 113306260 | 113326450 | - | Out-of-frame | - |
Page 1 of 1
bottom of page