top of page
Peptides from immunopeptidome samples
Use criteria below to search
Gene | Transcript | Peptide | Modified peptide | Peptide length | protein length | Chr | Start | End | Strand | type | High.efficiency.TIS.motif |
|---|---|---|---|---|---|---|---|---|---|---|---|
PRDM8 | XM_017008469.1 | QGRPLTHAWNAANVSSLSSPMWRICVSAAPR | Q[111]GRPLTHAWNAANVSSLSSPM[147]WRICVSAAPR | 31 | 38 | 4 | 80201519 | 80202024 | + | Out-of-frame | - |
PRDM8 | XM_017008470.1 | QGRPLTHAWNAANVSSLSSPMWRICVSAAPR | Q[111]GRPLTHAWNAANVSSLSSPM[147]WRICVSAAPR | 31 | 38 | 4 | 80201519 | 80202024 | + | Out-of-frame | - |
LOC105377947 | XR_001744294.1 | QGSESYFY | 8 | 36 | 6 | 111984150 | 111990586 | + | ncRNA | - | |
LOC105377947 | XR_001744295.1 | QGSESYFY | 8 | 36 | 6 | 111984150 | 111990586 | + | ncRNA | - | |
SVIL-AS1 | ENST00000427063.6 | QGSLFLHRWMNAVAAAPAWAMP | QGSLFLHRWM[147]NAVAAAPAWAMP | 22 | 32 | 10 | 29420820 | 29420918 | + | ncRNA | - |
Page 1 of 1
bottom of page